Skip to content
caramembuatblog
  • Blog
    • Auto
    • Finance
    • Construction lifehacks
  • About me
  • Contact us
  • Terms & Conditions
  • Privacy Policy
  • Sitemap
April 27, 2022 by Administrator

Honda Customer Service Number USA, Head Office Address

Honda Customer Service Number USA, Head Office Address
April 27, 2022 by Administrator

Content material of the fabric

  1. Head Office Address:
  2. Authorized Dealers:
  3. Honda Sevice Center Addresses:
  4. Video
  5. Our Operations History
  6. Quicktake
  7. Then This Happened

Head Workplace Tackle:

American Honda Motor Co. Inc. Honda Vehicle Buyer Service, 1919 Torrance Boulevard, Mail Cease 500 – 2N – 7A, Torrance, CA 90501 – 2746.

Working Hours:

Monday to Friday: 6AM to 5PM.

Approved Sellers:

Honda of Manhattan 627 eleventh Ave, New York, NY 10036-2003, Phone:(212) 315-3939.

Hudson Honda 6608 Kennedy Blvd , West New York, NJ , (201) 868-9500, Mon-Sat 9:00AM-9:00PM, Solar Closed.

Paragon Honda 5702 Northern Blvd, Woodside, NY, Phone:(855) 384-1853.

Metro Honda Route 440 North, Jersey Metropolis, NJ 07305, Phone:(888) 466-6977.

Bay Ridge Honda 8801 4th Ave, Brooklyn, NY, Phone:(718) 836-4600.

Plaza Honda 2740 Nostrand Ave, Brooklyn, NY Phone:(347) 554-8601.

Backyard State Honda 584 State Rt 3, Clifton, NJ, Phone:(973) 777-1600.

Bronx Honda 2541 E Tremont Ave, Bronx, NY, Phone:(718) 892-3300.

Hillside Honda Service Annex 14024 Queens Blvd, Jamaica, NY, Phone:(718) 657-7810.

Honda Sevice Middle Addresses:

Serra Honda 1813 Ensley Avenue, Birmingham, AL 35218, Phone:(205)491-8484.

Brannon Honda 300 Gadsden Hwy, Birmingham, AL 35235, Phone:(205)833-1233.

Tameron Honda 1675 Montgomery Hwy, Birmingham, AL 35216, Phone:(205)823-3333.

Townsend Honda 3121 Skyland Blvd E, Tuscaloosa, AL 35405, Phone:(205)556-0191.

San Francisco Honda 10 S Van Ness Ave, San Francisco, CA 94103, Phone:(415)441-2000.

Honda of Serramonte 485 Serramonte Blvd, Colma, CA 94014, Phone:(650)758-4800.

Honda of Oakland 3330 Broadway, Oakland, CA 94611, Phone:(510)420-9200.

Berkeley Honda Autocenter 2600 Shattuck Ave, Berkeley, CA 94704, Phone:(925)323-3177.

Honda of El Cerrito 11755 San Pablo Ave, El Cerrito, CA 94530, Phone:(510)412-6100.

Hillside Honda 13907 Hillside Ave, Jamaica, NY, Phone:(888) 212-8742.

Paragon Honda 5702 Northern Blvd, Woodside, NY 11377, Phone:(800)727-2466.

Metro Honda Route 440 North, Jersey Metropolis, NJ 07305, Phone:(888)466-6977.

Backyard State Honda 584 Route 3, Clifton, NJ 07014, Phone:(973)777-1600.

Bronx Honda 2541 E Tremont Ave, Bronx, NY 10461, Phone:(718)892-3300.

Hillside Honda 13907 Hillside Ave, Jamaica, NY 11435, Phone:(888)212-8742.

Honda of Downtown Los Angeles 1540 S Figueroa St, Los Angeles, CA 90015, Phone:(213)749-2331.

Honda World Downey 10645 Studebaker Rd, Downey, CA 90241, Phone:(562)929-7000.

Goudy Honda 1400 W Most important St, Alhambra, CA 91801, Phone:(626)576-1114.

Lengthy Seaside Honda 1500 E Spring St, Sign Hill, CA 90755, Phone:(562)426-4444.

Group Honda 13839 Whittier Blvd, Whittier, CA 90605, Phone:(562)698-8191.

Mc Grath Metropolis Honda 6720 W Grand Ave, Chicago, IL 60707, Phone:(773)889-3030.

Continental Honda 5901 S La Grange Rd, Countryside, IL 60525, Phone:(888)671-3180.

Honda Superstore of Lisle 4475 Lincoln Ave, Lisle, IL 60532, Phone:(630)852-7200.

Valley Honda 4173 Ogden Ave, Aurora, IL 60504, Phone:(630)851-5700.

The Honda Superstore of Joliet 3225 Plainfield Rd, Joliet, IL 60431, Phone:(815)439-2222.

For contemporary merchandise and extra data, prospects can refer the corporate Website.

Honda USA Social Media Community: Prospects can ship their suggestions and options to the corporate by way of the next social media platforms. Fb: http://www.fb.com/honda Twitter: http://hondaloves.tumblr.com/ Youtube: http://www.youtube.com/honda

Video

Our Operations Historical past

North America has been a vital a part of Honda since we first touched down right here in 1979 in Marysville, Ohio. We had been the primary Japanese automaker to convey our craft right here, and we’ve been rising ever since.

more

Quicktake

Then This Occurred A sequence that takes data-driven strategy to inform fascinating, in-depth tales about how coverage decisions have affected enterprise, politics and other people’s lives all through historical past.

Tags

The Powerbuild the futurepower the economy.pursuing the Powersupport the communitiesbeen the verywere the firstenjoy them.in the U.S.Including the Acuraworks to buildproud to provideContinue to seeclose to ourproud to havefirst touched downautomaker to bring1959. And wework and live.you and yoursProducts and Servicesservice and finance.manufacturing and dealerships. Investing inmobility in communitiesstore in Los
isnotatwithonitfrommyyouarewasbeasyourallbyoutusmewillbutornotheyonegetreplyaftersayswhathealsocontactwhichanbackwhensohadyearswouldifthemcaronlytheretimeemaildouplikejustnowtakelastpleaseveryknowagainhisanysaidampitsvehicleengineaccordpmcall

Previous articleThe Rollercoaster Bridge -- why Eshima Ohashi is so steep and so impressiveNext article Cost of Driving from Jackson, WY to Madison, WI

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

  • Auto
  • Construction lifehacks
  • Finance

Categories

  • Auto
  • Construction lifehacks
  • Finance
© 2022 caramembuatblog.info rights reserved.
Privacy Policy